DPCstruct | MC1753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 201 ± 32 aa |
| Standard deviation of domain lengths | 32.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452ZH68 | 9-194 | KNWPPFFPLIHHNISNEIPIHLQKMQYLAFSSFLGIALCLFFNIIATTTAWIKGEGVMVWLLAIIYFISGVPGAYVLWYRPLYNAMR… |
| A0A087SU44 | 29-237 | NRREAELRRLEQELRAGGAGSLKNWPPYCAFTYHDIRAEIPQPLQGMVRSAYWAYLGLVLCLFFNFVGTAAYLIGVDGGGIAAFLWG… |
| A0A0G4HWV5 | 2-218 | None |
| A0A4P1RM67 | 473-686 | None |
| I1GQK5 | 340-536 | None |
| A0A5N5ICA9 | 487-712 | None |
| A0A2K6UCD9 | 2-174 | None |
| A0A397UDY5 | 25-200 | None |
| A0A1I8ITC4 | 2-223 | None |
| H3BBM3 | 31-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.