DPCstruct | MC17529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 183 ± 30 aa |
| Standard deviation of domain lengths | 30.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8FX90 | 13-224 | ELFLLSDSGFTNSQLALRWLQHFAQHTAQYNNGELKVLLLDSHGGRRGATALETAGSEGQSYRNWLTGTEEVVVAGQLQELDLRTVR… |
| L8FMJ6 | 3-125 | AYGELAVLQHDLLSIKVANQQKAKIRSRSVLQTTSGPLTARDAQKKKEDKAKKHKESQERTANYRLQIALSKVKKALHKRGVEARKA… |
| A0A1B8EI40 | 95-305 | None |
| A0A176ZYB4 | 105-271 | None |
| A0A094DS14 | 6-201 | None |
| A0A2S7PC08 | 322-487 | None |
| A0A177A700 | 19-231 | None |
| L8GBB5 | 1-175 | None |
| A0A1B8C2W5 | 1-223 | None |
| L8G8K8 | 3-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.