DPCstruct | MC17528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 179 ± 25 aa |
| Standard deviation of domain lengths | 25.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8G1F2 | 1-145 | MSSSRHIKIKECHLLADRIEKNGNLMSPCSSCLHNNQFCIVVAGSHRCSECTHRNSKCNACAPFPTDWEKLRKEEEHLEVEEEAAAS… |
| L8FT83 | 1-177 | MSSSKHTKIKERLALSQRVLATGFEMPSCNRCEKKHLKCVVSDDSKCCSQCVRVNARCDACVPSISDWDKIEREEHCLQAEEEAAMA… |
| A0A0J9UPZ0 | 1-158 | None |
| A0A177A6B3 | 146-309 | None |
| A0A0U5G908 | 3-228 | None |
| A0A395IES1 | 1-203 | None |
| A0A0J9WCB0 | 2-176 | None |
| W6XVN5 | 8-158 | None |
| A0A093UKZ8 | 32-232 | None |
| A0A6J3LXP3 | 1-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.