DPCstruct | MC1752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 376 ± 30 aa |
| Standard deviation of domain lengths | 29.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10312 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068VHH4 | 21-392 | MGSDRTSRSRREISSSKSSHNRGSDDDRHQKKNRKITEDDIAEYLAKKAQKRAAKVAKKLKAQNISGYGNDSNPFGDSNLNERFVWR… |
| A0A087SQ04 | 1-376 | MGKDAKKSKKSKRSKEKKEKRRRRDSSDDSSSDEDARKQNKNEKLIQRIVEHQKKHKKVDSEYTDEANPFGDPNFSKPFVWGKKIEK… |
| A0A7J6VM91 | 4-368 | None |
| A0A0V0XYL7 | 33-400 | None |
| A0A060SPG6 | 10-346 | None |
| B4DSX7 | 1-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.