DPCstruct | MC17519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 152 ± 21 aa |
| Standard deviation of domain lengths | 20.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04608 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084Y336 | 2-111 | SDFELLGFLLLCFIGGVLAVHKTGVDLGVIDHGSIVWDEIVPFWLVLLFCPAHWLWQAGAFCLFRIFDIVKPPPARYFDEKVKNGFG… |
| A0A847S9T9 | 3-134 | PAPGTWGSLASWPLYLLMAHWLTPMQIVWACLPLFVLGVFCCARTGKALGVVDHGAIVWDEMVACWLLFALTPAALWSQLLALLLFR… |
| A0A388PWE8 | 321-466 | None |
| A0A7V4E589 | 107-252 | None |
| A0A3M1S6J6 | 27-198 | None |
| A0A521H057 | 71-238 | None |
| A0A8B3SZZ0 | 15-158 | None |
| A0A3B9YKF8 | 10-170 | None |
| A0A523K2C6 | 168-324 | None |
| A0A7C8CH18 | 9-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.