DPCstruct | MC17514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9MPH9 | 2-63 | AAEPGHLCNPSTEVMPCSYCGEPAPHVKHYCKGKMEDLQYVCEGCGRLAPSAELLCKPSKVP |
| A0A7V5K586 | 34-107 | MYTCKTCGAVSPEAGHLCDPTEASKVYTCEYCGAQSSKKRHICKPKLQQVKYFCENCGRVAVKEDDLCKPKPVG |
| A0A2K2VY50 | 33-105 | None |
| A0A1Q9MQF2 | 65-137 | None |
| A0A1G2WRF0 | 2-76 | None |
| A0A0F2QXT5 | 2-72 | None |
| A0A1G1E658 | 1-81 | None |
| A0A419EMQ3 | 1-79 | None |
| A0A7C4ALN7 | 18-93 | None |
| A0A842R3R2 | 82-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.