DPCstruct | MC17512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 43 ± 1 aa |
| Standard deviation of domain lengths | 1.45 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 91.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 66.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D5ND56 | 41-83 | EVRAVGGLHVILSEYHEAARIDRQLFGRAGRQGDPGSCEALAA |
| A0A7Y4YH84 | 15-57 | AVAKAGGLHVLATERHEAGRIDRQLYGRSGRQGDPGSFETLVS |
| A0A7X2UDH6 | 47-87 | None |
| A0A833AS54 | 30-73 | None |
| A0A7Z7GEB1 | 13-55 | None |
| X8FKZ7 | 2-41 | None |
| A0A0G1WNV2 | 2-42 | None |
| A0A7C6IHF8 | 21-65 | None |
| A0A831P5Q0 | 44-85 | None |
| A0A6D0END4 | 68-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.