DPCstruct | MC17511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 20.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6S410 | 683-784 | DAVLVTWDTMVLLVGPFGDTLQYFYSGPVFAITESDGVRVIGAETCDFIQKVPASSVSVFRPGSTSPSAILYDAWEQFSKRSPKADE… |
| A0A6S7M0X4 | 1-116 | MDSVLLYWDDMLLMVGPYGDLVRYLYDEPIILILECDGARILTKLNMEFLQRVPSSTESIFKIGSTEPTYLLYDALDHFYRRNAKVC… |
| A0A0R3R6T9 | 42-174 | None |
| A0A7R9H3L6 | 580-694 | None |
| A0A2P1JI57 | 139-295 | None |
| G0QSJ0 | 304-413 | None |
| A0A7R9J791 | 585-718 | None |
| A0A4Q9NB93 | 78-183 | None |
| A0A7R9AWN6 | 366-519 | None |
| A0A7S1XPQ2 | 98-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.