DPCstruct | MC17510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 278 ± 43 aa |
| Standard deviation of domain lengths | 43.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.78 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0004- PF08155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068VA19 | 22-242 | RKHYILANDEWKDNIMPEIMDGHNVYDFIDPDILQRLEKLEREEGIRQEQEANDDFEMDGAELTAEEQEALAEIRKKKSFLIQQHRM… |
| A0A6S7M009 | 42-334 | HVAMPKPLEERPVCISEGVFEAKAMEAEKVKRKLERENENENGGAGVYSASLKKHYLLADDEWKEDNMPEILDGHNVYDFIDQDILQ… |
| A0A4U0WWH5 | 370-655 | None |
| M3US28 | 9-293 | None |
| L5K785 | 13-391 | None |
| A0A7R9T4A4 | 1-196 | None |
| A0A842Z4Y5 | 1-243 | None |
| A0A182DZG9 | 368-641 | None |
| A0A674B509 | 67-270 | None |
| A0A0A9Y4F1 | 1-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.