DPCstruct | MC1751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 149 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2DBM2 | 1-152 | QNYNASDLQSYLPTVLLAKRALEKMQEELQSPRVNVSDPRTYEIMRKQNRAEPIKQLRKESFRTRMWLRETSGKISTAETEYQRLKR… |
| A0A087SNE2 | 1-136 | MSNYLKKRALEPLRYYVPSLLQARDQLSGLGTVMIEDAKEARSRLRTGAFAGLREAVNAVGEYTSRDGKQSTAFLRSLEDLDFSIFQ… |
| A0A3B6NVF7 | 451-604 | None |
| A0A452ZRR5 | 175-322 | None |
| A0A7S0NC60 | 100-247 | None |
| A0A6J1BQR4 | 2-154 | None |
| A0A7S1NZI3 | 155-302 | None |
| A0A7I4DUZ4 | 75-234 | None |
| A0A453DWI3 | 128-283 | None |
| A0A199VU86 | 7-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.