DPCstruct | MC17509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 41.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7LYC9 | 100-213 | DVEIAAVLRKKPIVLPKGALENFDKMKLDIIRKDGWCMAFQIREKSDVEFHRVCFSLADKHLYSTSCLKYNMELMNQCKANNSRDKK… |
| A0A6S7P2R6 | 180-294 | QKFKPIVIHLKRILVFYIQEVGKMDMEIDDVLRTRSTIQPKEALNDVSKMKLGKIRKDNWSVAFQQTEGKKVQKCLFCLPDKHLYST… |
| A0A6S7MZA1 | 122-229 | None |
| A0A2J6K9R9 | 184-306 | None |
| A0A6S7MX20 | 203-343 | None |
| A0A6S7MIS5 | 70-211 | None |
| A0A6S7NEZ4 | 25-133 | None |
| A0A6S7NDM5 | 75-172 | None |
| A0A6S7NBP6 | 2-113 | None |
| A0A6S7N9J5 | 168-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.