DPCstruct | MC17507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 51.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7LWJ1 | 28-113 | MNERKTIDLEQGWDFMQKGITKLKNILEGLPEPQFSSEDYMMLYTTIYNMCTQKPPHDYSQQLYDKYRESFEEYITSTVSELISFF |
| A0A2P5W086 | 1-64 | MEKGIEKLKRILAGEKETPFTSREYMTLYTTIYNMCNQKAPHDYSEQLYDKYKETLDEYITSIV |
| A0A1D6FUG2 | 1-87 | None |
| A0A811PC03 | 1-79 | None |
| A0A834Z4U4 | 9-86 | None |
| A0A445ELZ1 | 416-502 | None |
| A0A2Z6M817 | 1-79 | None |
| A0A2Z6LGB0 | 1-94 | None |
| A0A2Z6LG91 | 1-103 | None |
| A0A6P5SJ28 | 186-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.