DPCstruct | MC17506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 121 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6M8J1 | 19-125 | QILSWAYFQDLNCYVVKRERGILYFRYPHDFKTLPGFEVNQLARLKMLYSEDSVMSAWFSRQIQYEYQKRWINFKPQEPERYYQPEI… |
| A0A6S7LVU0 | 1-139 | MKNSNKGRKINEPQLTVTDLGKRKFGDQFGDRSGIKMWGFDHELKLWVVKRNPCNSEYYNNIHDFWSWMKVDLSELSKAPFHNPSKN… |
| A0A6S7NHJ7 | 11-118 | None |
| A0A6S7QE50 | 197-328 | None |
| A0A6S7MZ24 | 266-390 | None |
| A0A6S7NFS8 | 4-143 | None |
| A0A5N6P8D2 | 159-263 | None |
| A0A2J6JLQ2 | 1-112 | None |
| A0A5N6PU28 | 332-452 | None |
| A0A5N6PV77 | 104-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.