DPCstruct | MC17505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 172 ± 28 aa |
| Standard deviation of domain lengths | 28.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.04 |
| Pfam Score | 87.37 |
| Assigned Pfam label(s) | PF09785- PF01798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3B7J6 | 184-375 | YHNEIIKYLPPDTTKSALRILSAKVTLAARIDLAKSSPNGELGKKYRDEVVDKINKQLLPPEASGIKPLPKPTEFKSKRRGGRKVRK… |
| A0A6S7LEX7 | 29-195 | GRMYREEIRKKIEKWQEPPPAKQPKPLPVPDSEPKKKRGGRRLRKMKERYAITDMRKLANRMQFGVPEESSLGDGLGEGYGMLGQAG… |
| A0A7S0LW76 | 1-163 | None |
| A0A5K4FFZ8 | 1-145 | None |
| K3Y7C3 | 225-418 | None |
| A0A1I8F9J8 | 245-405 | None |
| A0A2T4CH56 | 73-276 | None |
| A0A0E0K4U1 | 21-231 | None |
| A0A183QW24 | 30-205 | None |
| A0A3M0KPM9 | 108-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.