DPCstruct | MC17503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 235 ± 12 aa |
| Standard deviation of domain lengths | 12.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 62.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7L7T2 | 1-258 | MDSYDFVDIVKAEKANALARYRRFTNMAKFFQLIEVFFAVALISWSSTRLPTVLKVSGEYLLAFSSYLMNQHVVFLLGNVIVVVCYV… |
| A0A5A7PRG7 | 1-231 | MVYPQAFDIVNLEKDRAAAAYNLLRKIAGARQILELVALLGLISWSTARVPAAATTAAAHAAWISAHLFNHRVAFLIGNAIVVLLFL… |
| A0A2R6RMR8 | 1-235 | None |
| A0A251RWJ1 | 1-237 | None |
| A0A5N6NKS2 | 1-232 | None |
| A0A5K0ZS01 | 1-235 | None |
| A0A6I9THU9 | 1-243 | None |
| A0A2Z7AM37 | 7-239 | None |
| A0A2U1PGA7 | 1-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.