DPCstruct | MC17501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 184 ± 17 aa |
| Standard deviation of domain lengths | 17.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9RH22 | 2-173 | ESSSVISPDDVLESLMNDGTIDALRLKIINQLKANEELKKTTITMVEQSKVLNTSGAEKQTKRELFDSLRQELEVPVLEKASKSVWD… |
| A0A6S7L5N6 | 9-197 | NGGVNHTISCNDLISKLKDDGDFDRLRLKIIRKLKENEELRKSIVSMVKQSVALNRPGSENMKPRQLSDTIHQEVGDRVNEQISNGL… |
| A0A7N0TX62 | 35-230 | None |
| A0A7I8J902 | 1-189 | None |
| A0A0A9CH70 | 1-154 | None |
| A0A5N6PPC8 | 1-155 | None |
| A0A1Y1HVR4 | 3-186 | None |
| A0A7J6X6L1 | 1-188 | None |
| W9RYI4 | 6-226 | None |
| A0A835M6G3 | 8-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.