DPCstruct | MC17500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 102 ± 16 aa |
| Standard deviation of domain lengths | 15.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.56 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0023- PF07516 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3D910 | 2-81 | VARMQELGLDAAEDPEAYEARWPEVLAQAEAAVEDAHRAVIAAGGLYVVGTERHDSRRIDNQLRGRSGRQGDPGESRFYL |
| A0A6S7L4G9 | 219-325 | KSWTYEKAKSIISESIEMSQSMGLDELQRLVEEQAEMYPLGPCIAIAYLSVLKDCEIHCFHEGLEVKRLGGLHVIGTSLHESRRIDN… |
| A0A453HJG5 | 180-287 | None |
| A0A6A2XGH6 | 191-287 | None |
| A0A2N2M9Z4 | 176-274 | None |
| A0A7H4PA60 | 68-138 | None |
| A0A4S4D2N0 | 12-120 | None |
| A0A6S7N2R9 | 259-365 | None |
| A0A068UTN1 | 18-132 | None |
| A0A2C9WER3 | 268-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.