DPCstruct | MC1750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 269 ± 36 aa |
| Standard deviation of domain lengths | 35.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 56.94 |
| Assigned Pfam label(s) | CL0198- CL0021- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3J2W3 | 6-211 | SPVPDPLFAAFCAAGLWPGLGRTSAERLPAAGIRSPADVDLARLSAVEGMTGPRARRLLDSFRASTGRYEVAGLLADASLPVRLARG… |
| A0A087SKA9 | 22-319 | ALAAASTEGEVVEVGGVVQKVWFKSTETGYAVLRLRADSPRGAEAITVVGTLAHVAEGQALQLQGSWKRHPQYGRQLAVSEAVQVAP… |
| A0A837ZDU0 | 2-220 | None |
| A0A1V1V8T8 | 1-327 | None |
| A0A257SUE3 | 56-347 | None |
| A0A1Y5EEG9 | 669-875 | None |
| A0A3S6Z139 | 1-209 | None |
| A0A6M3K1Q0 | 3-255 | None |
| A0A1V5RDL8 | 1-301 | None |
| A0A2T3L8K0 | 9-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.