DPCstruct | MC175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 269 ± 36 aa |
| Standard deviation of domain lengths | 36.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3IC53 | 44-330 | HHYASAKEGRELMLSNTEYYENVTQIDIDNRLGKSGGTLDELLEASTAEVKSFNIFEKYIIDRRIANMAKTIARNDYELPYLEEIVF… |
| A0A6C0B3J1 | 31-290 | MQELFNNPINYEPDHFKRYINNISPKVYFTKTKIKIDSKEEFGSVYLSLLGKVPYYKQAQLDLYTERINKAFRDVNLQNIARTPTEY… |
| A0A6C0HP16 | 56-380 | None |
| A0A6C0LMN5 | 15-228 | None |
| A0A821W1Y1 | 1-221 | None |
| A0A354FNR9 | 223-512 | None |
| A0A2E3MSC6 | 268-567 | None |
| A0A250XN41 | 489-731 | None |
| D2R1W2 | 51-332 | None |
| A0A3A5FG74 | 24-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.