DPCstruct | MC17498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1P971 | 12-129 | RIDVLISPMMFSLSLASPNYKKLLSSLGIPCIQAMTTMQPYDEWFDSTQGMTTMEVSYTAAQPEFDGNLITVPFASREQEKIDPITG… |
| A0A7W1GJ31 | 3-124 | DGASRVSQIISLTGFSFVGGPAMNDSEAAVKFLSDLNRPFRSTVSLDVQTVEAWRESATGLNPVQAGMQIAIPEIDGATEPFVFGGM… |
| A0A0F4JP73 | 26-118 | None |
| W4TWM9 | 1-146 | None |
| A0A090T6Z7 | 73-186 | None |
| A0A7W3WEC9 | 69-186 | None |
| A0A136ME51 | 275-380 | None |
| A0A3R6L5B0 | 292-416 | None |
| W4U3Q9 | 25-146 | None |
| A0A5C7K7K7 | 282-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.