DPCstruct | MC17496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 173 ± 13 aa |
| Standard deviation of domain lengths | 13.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 65.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 63.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7NNG0 | 7-173 | MVSDDSGDAFYSENEDGFDYSADDSDDSDYIVHESNMQFDVDVDMSEFQSPVDVDEHGILNKQTESIGNDIVDEELGVIQSDDYQYA… |
| A0A6S7NNN6 | 142-305 | MVSDDSGEAFYSESGHGSEDSGDDSNDSEYNVDESNIQFDVDVDMSEFHNVVDVDEHGILNNHSKDEGIDMVDDELEVIATNDYQFA… |
| A0A6S7MGC1 | 3-159 | None |
| A0A6S7MCE2 | 3-165 | None |
| A0A6S7MBZ3 | 56-236 | None |
| A0A6S7LGC3 | 108-298 | None |
| A0A6S7LIZ9 | 1-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.