DPCstruct | MC17495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368DTU5 | 35-130 | PLIDELNDENISWIALKKEDGELRLTFDYLIHHKCVIKEVRYGINQSMPNNILVLPTCNGDIKKIETYRTLPPSATSISIYLTLNNG… |
| A0A1I6GM27 | 24-129 | SAGVKPILELIRPQWIAIRPYNGQDLLYMTTLLTYRCGIEQIRFSYNGGALQVWDGEPCYRDEASPMALKLETHLPYAVAPLESLQT… |
| A0A357CL51 | 17-114 | None |
| A0A838XQG8 | 623-725 | None |
| A0A7X8T437 | 312-410 | None |
| A0A161V808 | 42-150 | None |
| A0A4R2NIY1 | 2-88 | None |
| A0A7W6SZI5 | 4-94 | None |
| A0A3C0BVR3 | 1-79 | None |
| A0A1G6E024 | 22-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.