DPCstruct | MC17494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 7.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07927 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L8I1F9 | 13-88 | RSRLPPLRPLPYRRVARKLMAAGFFPVDQRGSHVKFAKTTVAGDRRVIVPRHREVQIGTLRSILRQAGLTRDEFER |
| A0A6H2C245 | 5-72 | PIVNYKTLNQLLIKLGFSVVRQKGSHVFYRHSDGRTTTVPNHQGRDLARPLLREILKEIELTVDNFNE |
| A0A662Q257 | 3-94 | None |
| A0A7V4A0K6 | 6-83 | None |
| A0A1S7PQT3 | 24-98 | None |
| A0A2I0P4N8 | 1-71 | None |
| A0A8B5X2P2 | 11-84 | None |
| A0A143YQB5 | 1-55 | None |
| A0A450YXX1 | 85-154 | None |
| U2BQS6 | 232-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.