DPCstruct | MC17491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 156 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17661 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401S7K3 | 241-391 | EEEDQPLVKDNMDNEDDYLFIIDQTARDFLVIRAPDYESYYSRQQKDKKVLFTPSILTVATSEKIPEDMQPRFLEDEGIYVGERPKV… |
| A0A3B4BJM8 | 27-165 | VQDDRDNIFVTEQSTQDFIVVKKAEYIGYHKRLQHTGDLLFTPSVRPVTTCVKLPENIKPRYLEDEGLYVGERPPVSSTNMNILENR… |
| G1NTL1 | 3-154 | None |
| A0A0P6J9V5 | 68-237 | None |
| G3PLR0 | 227-373 | None |
| A0A6P7E7A9 | 189-332 | None |
| A0A7F8K3W2 | 143-285 | None |
| J9NTS9 | 63-246 | None |
| A0A6A4JXR7 | 203-367 | None |
| A0A480LAX9 | 227-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.