DPCstruct | MC1749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 273 ± 45 aa |
| Standard deviation of domain lengths | 45.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672QB40 | 1-178 | VNFISHATQSRLRTVLEKVSSIAQHRMDSCKEDEWHEPSSDVRSQLKFFEQLERMEKQRKDEREREILLRAAKSRSRQEDPEQARLK… |
| A0A087SJ39 | 106-347 | HKKDRDGDIDEILGADAFIDMEQETDTLMAGLQVQRTQGLASVAASQTLSEWRLGNECVKQMRAAGLKVLKPECFEVIQRAFQSQAE… |
| A0A0K9QPZ5 | 598-926 | None |
| A0A3P9H2K8 | 36-260 | None |
| A0A6L5DGV2 | 6-246 | None |
| A0A6P4YZ28 | 883-1125 | None |
| A0A0H2RYH2 | 121-489 | None |
| A0A1B0A288 | 930-1190 | None |
| A0A2B4SC64 | 568-828 | None |
| R9AA96 | 1-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.