DPCstruct | MC17489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0630- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NUG2 | 231-334 | KCTVADYEQIQCGQPGISGAECEAINCCFNGQQCYYGRAVTVQCVRDGQFVVVVARDVTLPRLSLDSVRLVGGNEPPCGPVDSTPFF… |
| A0A3B4BA07 | 1-120 | NKLLYLALFNNTSSFRLAQMYCAFPTVERVPCGPLRISKLQCNSMGCCWDQVSSSCFYPMDECTNDHHFVFSIHHDTTSVRLNPSSL… |
| A0A401S2J1 | 751-878 | None |
| A0A3B4DFB9 | 222-338 | None |
| A0A2D0QJM8 | 37-158 | None |
| W5LXE7 | 25-122 | None |
| A0A444U0Z2 | 145-261 | None |
| A0A401Q3L7 | 25-138 | None |
| A0A3Q2ZTE3 | 658-766 | None |
| F8TW89 | 236-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.