DPCstruct | MC17487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 179 ± 23 aa |
| Standard deviation of domain lengths | 22.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182Y7P5 | 1-146 | MRPIKLGVVFGIVAAHEPGWNDPPPKLVGKKPAPTTDATDSLPDREEMFRQTQTVFDDYVQSVEEARRPTVQKRFQLMYQQWTDKKL… |
| A0A3B4B198 | 5-190 | GRGEGQRRRGAEEQRVRGQRAPPAGQRAPPAGQRAPPVGQRAPPAGQRAPPAGQRSDSVQSEREPEVEEVMSVLNAALEACHGTTSV… |
| A0A6S7GJN2 | 265-466 | None |
| A0A6U0VJ41 | 44-259 | None |
| A0A0A9Y427 | 1-192 | None |
| A0A2R7VTI2 | 80-247 | None |
| A0A4Z2HQR1 | 31-185 | None |
| A0A7S2QVW0 | 130-318 | None |
| A0A7M5UWH7 | 217-413 | None |
| A0A818AA74 | 13-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.