DPCstruct | MC17485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0RVZ8 | 1-78 | MSGRVGDLSPEQQEALTRFRDNLQDLLPTLPKADDHFLLRWLRARNFDLQKSEDMLRKHVEFRKQQDLDNILEWKPSE |
| L5L5F2 | 1-78 | MSGRVGDLSPSQEEALAKFRENVQDVLPTLPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDTDNVISWQPPE |
| A0A2G8LFI1 | 4-79 | None |
| A0A090XCF9 | 1-64 | None |
| A0A498NGC2 | 503-581 | None |
| F8WEE7 | 1-78 | None |
| A0A6I9K6R2 | 1-78 | None |
| A0A673W4V9 | 59-139 | None |
| A0A4Y2DS55 | 1-74 | None |
| A0A669PXB5 | 290-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.