DPCstruct | MC1748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540K5E8 | 76-154 | NRIIWSTGPRVFKRFTLPSPVITACWCRLGDMTEALLCVLQVACLTIYNTSGEVVSVPLSRTITSVWPLPFGLLLQQAA |
| A0A087SJ31 | 1-94 | MLPPSPHFARSGRAEWRIGGLLSSAYTCPSPLIDATWCIFPYLEPHPRPWLALLCARAQLSLYSLDSEEHRVPLPHGYTTVFPTPLG… |
| A0A843UMY6 | 142-220 | None |
| E1ZHU0 | 28-105 | None |
| A0A1D6M2K7 | 74-154 | None |
| A0A452YX11 | 125-203 | None |
| M0VCV4 | 3-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.