DPCstruct | MC17477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 99 ± 14 aa |
| Standard deviation of domain lengths | 13.79 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.60 |
| Pfam Score | 98.37 |
| Assigned Pfam label(s) | CL0063- CL0186- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9XWV4 | 327-427 | DGKKIIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIELFTKPDEYPTGVYVLPKHLDEKVAALHLDALGVKLTKLRPEQAEYIG… |
| G7YXQ7 | 203-296 | LAEGRLVNLGCAHGHPSFVMSNSFTNQVLAQLELWNNSDAYSIGVHFLPKKLDEQVAAAHLEHLGVKLTKLTPVQADYLGVPIDGPF… |
| A0A816WV47 | 256-348 | None |
| A0A818VQW3 | 434-529 | None |
| R9P3J3 | 336-429 | None |
| A0A820FLS7 | 1-81 | None |
| A0A3Q0JFI5 | 185-294 | None |
| A0A812ZMG3 | 607-717 | None |
| A0A0D2MXV8 | 936-1031 | None |
| A0A182Q529 | 130-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.