DPCstruct | MC17476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 11.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3Y1Y8 | 101-243 | DDSDSSDDDEEDAAAAAAARAKKKEEERKKAAAAALAWIKKDESSPKPEQKKTPRSERVQGEAFKRVCSDTWGSAIKHDALKDNSYE… |
| G7YWL9 | 2-126 | VDVDSGRRSLPAVSDTWNGVNSSEKRGMHCRFLSPFAAGSLSGHKSRQSFPFRRVPDDIELIDPQLSNNSYEAKPNSRGAWGERAYK… |
| W6UFL6 | 75-203 | None |
| A0A3P9BN80 | 800-939 | None |
| A0A6A1UVK1 | 237-370 | None |
| A0A674HBV4 | 401-538 | None |
| A0A6P4ZMR0 | 615-737 | None |
| A0A4P1RV82 | 80-230 | None |
| A0A1X2ILF1 | 2-118 | None |
| H9GL82 | 596-729 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.