DPCstruct | MC17472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 209 ± 28 aa |
| Standard deviation of domain lengths | 27.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12726 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1QQ38 | 1-240 | MAMAARRVQLADRWRGIQEAEEADDDGGGGEPSAARQRRLNQAKEEWFSHCFNFLGSLPKEEHIWCGYADIMGPFLETFLGYFDDQE… |
| A0A6N2LBK7 | 2-234 | AKRELLLDRWRTIEEEEELHADDGDNPVIRRRLHLLKEQWFADTFKYLISLATEEHIWCGNFDLMAPLLETFYNYYKDDRLDSPLRL… |
| A0A1D6I7H4 | 2-237 | None |
| A0A388LZL8 | 13-237 | None |
| A0A835QK60 | 11-237 | None |
| A0A2P2M1G6 | 1-169 | None |
| A0A446UEE7 | 1-170 | None |
| A0A453L5Q7 | 1-201 | None |
| A0A453L6E6 | 2-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.