DPCstruct | MC1747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 12.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087SGH9 | 17-122 | LDIHVYDLFDSVPCNGTCGMTQFVECVPHDQTNCRIDETFNIGNNNVGLNNWGNSNQGSYNIGSNNMGNSNRGSNNTGTGLFCNNLQ… |
| A0A1D1ZNK1 | 100-177 | VECLKAGQEACTADKDGNIGTGNKGKYNFGDNNEGDWNIGSSNKGNLNWGNNNRGTKLRCNNAVGTRKFRNLCSLKEL |
| A0A1D2A9N3 | 100-185 | None |
| A0A3M7L4L5 | 194-274 | None |
| A0A3M7L0S3 | 1-105 | None |
| A0A3M7KUX0 | 151-236 | None |
| A0A3M7KQ29 | 32-115 | None |
| A0A1D2A7H9 | 44-139 | None |
| A0A3M7L5C6 | 185-260 | None |
| A0A087SPC0 | 28-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.