DPCstruct | MC17463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 166 ± 14 aa |
| Standard deviation of domain lengths | 13.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5W0U1 | 76-245 | NTLDELVKLHAVYKYSLAANGYGEDDQFSLCHIFPIQHPFFIGTMHADNLVISYRNLNAKHGASVVNASSGHKIGRMTLNPKWAVSS… |
| A0A2V0QR31 | 1-176 | MLAPEKNREHSIKLQLPAWNVGFMRRLRTMELIRNRPAGHVHLCHVAPVKGNQCIGLLHYNLYYGGDYQNNIFRNSYAGGGLYIYVE… |
| A0A7X1X038 | 72-231 | None |
| A0A3R8W0Q5 | 1-139 | None |
| A0A2T4F6G7 | 1-186 | None |
| A0A2N0DYG4 | 81-265 | None |
| A0A514YR94 | 46-208 | None |
| A0A0N0L8N5 | 1-172 | None |
| A0A0H2ZCI8 | 95-265 | None |
| A0A1L7FYQ9 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.