DPCstruct | MC17458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 8.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4I359 | 2-122 | ISGKCIVCEADKNGFPIIEDAVIRAIRAVKKGLKMAKGNTLIVCASCVEQYKKKRSDFEKALVQYGLLGAFLLLILVAVPLFIGGSF… |
| A0A7J4B3Z5 | 33-148 | VKGVCIYCGAEKNSKPQLVQGYPIKEDYVINAIRWIKRKTKTEQGNRLVVCKKHVEEHRKKRADFERRLIMYGGLGFIVMLILLALT… |
| A0A7J3DJ61 | 2-119 | None |
| A0A7J3BRA5 | 4-141 | None |
| A0A7J2ZF43 | 3-111 | None |
| A0A7J2Z1I4 | 1-132 | None |
| A0A5E4HZ48 | 1-117 | None |
| A0A7J4JQD8 | 31-144 | None |
| A0A842WDY2 | 1-121 | None |
| A0A7C5U0H8 | 2-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.