DPCstruct | MC17456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 8.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0X6W1 | 4-75 | FDIRNVIGALLGLYGLVLCACFFFLDPGVNPEDMAAKEASDNLWTGLGMVLVALMFFAWARLNPIRMENNDA |
| A0A6J4P9J7 | 17-84 | GTRTAGALDIRNIIGGLLGIYGVILVVMGLFADTEPDKTGGVNANLWAGIALLVVGVGFLAWARIRPV |
| A0A7X0IH14 | 104-191 | None |
| A0A7X9C9P0 | 1-73 | None |
| U1Q591 | 45-129 | None |
| A0A3C0MRV6 | 1-89 | None |
| A0A347Q8W0 | 2-71 | None |
| A0A6A0B4R5 | 17-100 | None |
| A0A0N1GIB2 | 50-124 | None |
| A0A179B5T8 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.