DPCstruct | MC17455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1U0Q1 | 48-109 | PVVSVHDAASHSLAWIGSALGTKQYTLGVDRFGESGTIADLHEVTGISTGNIVNAALIAVSE |
| A0A6J4NXJ0 | 5-72 | AAHAPAPLLTVQDGHPHTLAFLAGVRGDRIRCLGVTEFGQSTSLEEAYALHGIDAPAIVDAALGLVGR |
| A0A1S8D7S6 | 74-146 | None |
| R1F4V9 | 358-424 | None |
| A0A7W0UGF1 | 4-61 | None |
| A0A0P7IFS5 | 7-67 | None |
| A0A839XYL4 | 2-61 | None |
| A0A7V7BZ32 | 8-80 | None |
| A0A7K0JXP1 | 15-78 | None |
| A0A845MHE5 | 207-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.