DPCstruct | MC17453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A131Z2L0 | 38-131 | LTCGSGQSTATKCTLVRLDTPAGYKTVGCRTFCKGPDNVVPRFNGYDCIHLEDDKAVNYMKEGANYTCRLGLCNNVGECNPWDLYLG… |
| L7MA80 | 9-130 | VVAVVYAVQLLCGAHESSHGSHSTSLSEEDPDNSAAEYPEYYYDDGTCTYPAIHVPDNKTLALNCTANCFKGRTAVLNDTIPCVNAT… |
| A0A0C9R5W8 | 69-179 | None |
| A0A6G5A437 | 1-122 | None |
| A0A6G5A9C1 | 69-206 | None |
| A0A0K8RLH5 | 1-125 | None |
| A0A131Z753 | 13-143 | None |
| A0A131Z589 | 1-126 | None |
| A0A131Z7C3 | 1-111 | None |
| C9W1C3 | 5-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.