DPCstruct | MC17452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 730 |
|---|---|
| Mean domain length (aa) | 293 ± 72 aa |
| Standard deviation of domain lengths | 71.98 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 75.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.27 |
| Pfam Score | 40.55 |
| Assigned Pfam label(s) | CL0210- CL0003- PF00439- PF20722- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267G558 | 122-357 | RRPRRIDTNLAHFKASEFRLFLLYLGPFFFRKFLPQKYYDHFLHLHFSIYVFCSDVHQTLLPNAHRCIEIFVKEMESLYGEASISYN… |
| L7LXU5 | 23-287 | LPPNFHKHFCLLVSAIHLLLKDRITREDISDAMGKLSDFVFKMQNLYGEASMTFNVHQLLHLPRSVVELGPLWAHSTFVFESGNGVL… |
| A0A1D1WC90 | 2-144 | None |
| A0A2N0QZZ2 | 3-276 | None |
| A0A5N6PY54 | 38-462 | None |
| A0A822CXB7 | 146-416 | None |
| A0A6D2JTG5 | 55-252 | None |
| A0A6S7FJP3 | 298-593 | None |
| A0A6S7FWX0 | 16-234 | None |
| A0A6S7FXA4 | 350-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.