DPCstruct | MC1745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 119 ± 19 aa |
| Standard deviation of domain lengths | 19.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087SF51 | 16-128 | AAAPSPVLLPALASPASAASEADWAGRMVTLWLDEEWTPLPEHAALGRAVCESVERLSSAAEGPLDASGLVIDLAGALAACDYHATF… |
| A0A830D1T3 | 2-87 | QESEWLRVTLHKWLDDEYCPEPTNIDISEIAAKSFYKSLVEKRADLGDILLRMALELESISYQESFHGAFSSANAAVNLIVQRILE |
| A0A811RBR0 | 6-113 | None |
| A0A7R9UUN2 | 19-146 | None |
| A0A6T6BSA5 | 57-189 | None |
| A0A4U5QSW3 | 110-248 | None |
| A0A7S0YXN0 | 50-168 | None |
| A0A6M0F5M1 | 6-106 | None |
| A0A7J6XA92 | 717-859 | None |
| C1MM88 | 2-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.