DPCstruct | MC17449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8N733 | 1-61 | MVLNSHHPVFPLDQHNAYNDAELVDLVSSYDNVVAWLNGHNHAGNYGFTGGTHFIRASGTL |
| Q4S9U6 | 28-91 | VIIACHLPVHPKAADPICLVWNFDDVLAVIRSHNSVVCFMAGHDHDGGYYLDEDTGVHHVTVEG |
| A0A7S1PFD3 | 525-594 | None |
| A0A3L8RZ08 | 2-76 | None |
| A0A818F837 | 1-76 | None |
| A0A7J7INH7 | 201-263 | None |
| A0A7S2WCY7 | 68-135 | None |
| A0A1Y5HZB4 | 133-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.