DPCstruct | MC17447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 9.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7PZV9 | 232-314 | PGYLASSTTSVTTGTGSKTWTTQTGLAYSVGARIRVWSTGSGDWMEGVVTAYNTSTGSLTATMDRASGSGTRTDWTINLAGEM |
| A0A3S3K7N1 | 66-146 | PELIAASTTSLTIGLGSQTWAVPAGKSYEVNMTVRAASDASASNYMEGFVTAVDAVAGSLTVNVTAIGGAGTFADWTLKVK |
| A0A1M5PXF4 | 63-169 | None |
| A0A7Y3T6U4 | 93-177 | None |
| A0A2D6E2N9 | 57-139 | None |
| A0A516H5U1 | 31-120 | None |
| A0A2A6NRC3 | 295-379 | None |
| A0A239GV83 | 55-165 | None |
| A0A0A1VCF9 | 273-356 | None |
| A0A7X6FSQ4 | 14-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.