DPCstruct | MC17444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 180 ± 17 aa |
| Standard deviation of domain lengths | 16.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4R2I8 | 10-179 | QATYTDNTGVLWTYFQDNDAPSVYYIVPRPVFSIPQNGVAQFHLTEWVDGNGEFLSAQCQLATMLTVPDAVIQAVGSALQQKGVAEP… |
| A0A7W0GIJ0 | 10-162 | LVVADDGRTVTVVPGGPEPERGPTGTPMVTLLGAPASASLNVGVRWWPAEDELHRLLAAEAKRRKVDPALFRVAADSLSGVRTALHL… |
| A0A7V8VEQ3 | 39-233 | None |
| A0A2X4UM11 | 9-171 | None |
| A0A5B7QZ63 | 80-282 | None |
| A0A0S4LMJ2 | 4-167 | None |
| A0A0S4LM51 | 55-212 | None |
| A0A813SDY2 | 14-193 | None |
| A0A817M2E0 | 14-206 | None |
| A0A1Y6CB44 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.