DPCstruct | MC17441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 6.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.54 |
| Pfam Score | 71.24 |
| Assigned Pfam label(s) | PF06507- CL0405 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VZ70 | 25-111 | RGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIRDEKSQLLLGIRRATRPQPALSSSVLSSDSMHIGILAAAAHAAANSSPFTIFYNPR |
| A0A6P4DT78 | 1-97 | MLTTEWSLFVSRKKLFAGDSVLFIRDEKQQLLLGIRLANRQPANISSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFV… |
| A0A2P2MQ06 | 68-167 | None |
| A0A811MSL8 | 2-88 | None |
| A0A6A6KYE4 | 354-439 | None |
| A0A5N6Q2D9 | 133-222 | None |
| A0A5B6VZZ1 | 32-112 | None |
| A0A4Y7J6E6 | 33-120 | None |
| A0A2G2X6F1 | 113-197 | None |
| A0A0D3D8S9 | 11-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.