DPCstruct | MC17440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 216 ± 12 aa |
| Standard deviation of domain lengths | 12.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20819 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839P3D4 | 1-222 | MVVAYPAPVRTLLAARVMASGVCLPHEEMAALNERFEVPPVRNYGSVTDAKRFVDEARSAAGIEGYVVCFADGHRLKLKSDGYVLRH… |
| A0A6B3N2W5 | 1-195 | MRHNREKLILHGARNIQTLQEELPSKWEGKYGWEIVKTYPLTTLPLIIKATEALDPMISEGYIVCDHRFNRLKVKSAKYIEISSAKS… |
| A0A817MUJ2 | 11-235 | None |
| A0A816DJM9 | 68-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.