DPCstruct | MC1744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2604 |
|---|---|
| Mean domain length (aa) | 178 ± 43 aa |
| Standard deviation of domain lengths | 43.24 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 10.50 |
| Pfam Score | 84.75 |
| Assigned Pfam label(s) | CL0032- CL0507- CL0314- CL0573- PF11527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087SBM1 | 24-188 | DPTSDIVLEQVTYEAGVYKAVGSFLTAASPPTVYDLLTDYPTLPRIFTSIAECREEAGKEGDSLLRQTCLWEFLGFSGQFDSLLRVS… |
| A0A8B2NW30 | 10-172 | SKSAFSTDIDVPIEKIDIADWLFNLPEAEYKRCCAPDHIGAGTTATDDGKRMSINVEMIGTALVIQHYVAEEAGPTYCRMNSISDVF… |
| A0A6G0X3S4 | 3-143 | None |
| A0A6G0X7Z5 | 180-404 | None |
| A0A6G0X837 | 9-148 | None |
| A0A6G0XM21 | 59-325 | None |
| A0A6G0XNE6 | 21-251 | None |
| A0A6G0XR36 | 17-178 | None |
| A0A6G0XRV4 | 32-259 | None |
| A0A6G0XUX2 | 6-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.