DPCstruct | MC17436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 14.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2PK72 | 20-123 | GEKMKSIETKSGLVIANDYTRIVHGGRGDYIEIDKTQIVETNINIPESEKWRREYGMAYYLEFRSNDENSVKIYYQLRTVSYADYQI… |
| A0A812Y340 | 67-200 | NRQRDKSRVENSLGLAEFGDAWTEFYGTSTGLPIGRGYDRIVYGDHGPYVEFSAHQLCWSTFPAFVEKPEMSFFDEYYTADGLTMLY… |
| A0A812YKM0 | 62-184 | None |
| A0A5B1BZA0 | 23-151 | None |
| A0A3E4YKL3 | 393-514 | None |
| A0A2D6MD95 | 5-115 | None |
| A0A5W3ESE5 | 19-141 | None |
| X1CSU7 | 9-115 | None |
| A0A0F9DSP3 | 1-96 | None |
| A0A7S4LPC5 | 418-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.