DPCstruct | MC17434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 67 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1NC53 | 4-62 | KEFVVNNLITLRLEGGKTNLYINGKLYIHCKSLILNIPINEIEMLEDIESIEEAVEKLK |
| A0A7C1QYS4 | 4-74 | REFKVNNLITLELFNGKTVIFVDGEEFKHCKAILFKNPINKITYLKNVESIDELAERMYILLLKQQLSYLN |
| A0A0F8XHH9 | 4-65 | None |
| A0A0F9L1Z7 | 1-60 | None |
| A0A0F9RFN8 | 108-170 | None |
| A0A0F9GYG6 | 1-71 | None |
| A0A0F9KL15 | 1-57 | None |
| A0A0F9N8G7 | 9-70 | None |
| A0A524C4D4 | 14-80 | None |
| A0A7J2PVA8 | 2-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.