DPCstruct | MC17431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 127 ± 22 aa |
| Standard deviation of domain lengths | 22.39 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.02 |
| Pfam Score | 91.54 |
| Assigned Pfam label(s) | CL0123- CL0167- PF11149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F5RND0 | 49-137 | PFTNKVYCASCGSKCERDTWTKGTKVWACSQPRTKCQLRRLPESKLKEAAESLFGDCYEGKIVQNVERITISDDEVIFQLKEGGAYR… |
| A0A178GZP5 | 2-110 | QQSGRKYLLQGLVICQCCKSVYYGMSNAKGGRSYYRCPGKRFGECNSKSIRADILEEVVWEEVKMVREHITKEKCDLSEADWETKLN… |
| A0A559KCX9 | 8-107 | None |
| A0A7J9Y2L2 | 2-121 | None |
| A0A328NSS4 | 69-156 | None |
| A0A1C6KWI0 | 33-199 | None |
| A0A7D7VF89 | 39-184 | None |
| A0A1M3PZ89 | 114-252 | None |
| K1UD28 | 5-112 | None |
| A0A2G2M0F3 | 100-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.