DPCstruct | MC1743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 207 ± 27 aa |
| Standard deviation of domain lengths | 27.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09991 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z2STA7 | 3-207 | KSRRLTEGALMAGIYLILLLLSLYMPIIGPFMIFVLPVPFAYYAHRHGWKPGALVFLVALIFSLLFATVISPVTLLAGIGGLFLGGA… |
| A0A087SB48 | 6-190 | AVIYTLASVARLDSYASYFLPLPTILVALRHGHTAALRAVLVSVLLLLVLTGPLRAATFLCMHGAMAVALGVAWAARLPWALSIPLA… |
| A0A7S3UDR4 | 126-351 | None |
| D4TMY4 | 5-175 | None |
| A0A4U5NPY5 | 79-302 | None |
| A0A251WMQ2 | 43-241 | None |
| A0A7S0YPV5 | 75-279 | None |
| A0A350MTI1 | 9-244 | None |
| A0A4D8ZU06 | 929-1149 | None |
| K8EGP1 | 32-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.